Protein |
||||||
Protein Name | Major histocompatibility complex class I-related gene protein | |||||
---|---|---|---|---|---|---|
#PDB ID | 31 | |||||
Organism | Homo sapiens (Human) | |||||
Uniprot ID/ACC | Q95460 (HMR1_HUMAN) | |||||
Synonym(s) |
|
|||||
Gene Symbol | MR1 | |||||
Gene ID | 3140 | |||||
Sequence | MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPLVMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDR | |||||
Protein Class | CELL CYCLE | |||||
Function | Antigen-presenting molecule specialized in displaying microbial pyrimidine-based metabolites to alpha-beta T cell receptors (TCR) on innate-type mucosal-associated invariant T (MAIT) cells (PubMed:23051753, PubMed:26795251, PubMed:12794138, PubMed:19416870, PubMed:22692454, PubMed:23846752). In complex with B2M preferentially presents riboflavin-derived metabolites to semi-invariant TRAV1-2 TCRs on MAIT cells, guiding immune surveillance of the microbial metabolome at mucosal epithelial barriers (PubMed:26795251, PubMed:24695216, PubMed:20581831). Signature pyrimidine-based microbial antigens are generated via non-enzymatic condensation of metabolite intermediates of the riboflavin pathway with by-products arising from other metabolic pathways such as glycolysis. Typical potent antigenic metabolites are 5-(2-oxoethylideneamino)-6-D-ribitylaminouracil (5-OE-RU) and 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil (5-OP-RU), products of condensation of 5-amino-6-D-ribityaminouracil (5-A-RU) with glyoxal or methylglyoxal by-products, respectively (PubMed:24695216). May present microbial antigens to various TRAV1-2-negative MAIT cell subsets, providing for unique recognition of diverse microbes, including pathogens that do not synthesize riboflavin (PubMed:27527800, PubMed:31113973). Upon antigen recognition, elicits rapid innate-type MAIT cell activation to eliminate pathogenic microbes by directly killing infected cells (PubMed:24695216, PubMed:27527800, PubMed:23846752). During T cell development, drives thymic selection and post-thymic terminal differentiation of MAIT cells in a process dependent on commensal microflora (By similarity). Acts as an immune sensor of cancer cell metabolome (PubMed:31959982). May present a tumor-specific or -associated metabolite essential for cancer cell survival to a pan-cancer TCR consisting of TRAV38.2-DV8*TRAJ31 alpha chain paired with a TRBV25.1*TRBJ2.3 beta chain on a non-MAIT CD8-positive T cell clone (MC.7.G5), triggering T cell-mediated killing of a wide range of cancer cell types (PubMed:31959982). |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
COVPDB171 | 30W | 4PJI | Kd : >200000 nM | PDBBind | SHOW | |
COVPDB387 | 7WQ | 5U2V |
- |
- |
SHOW | |
COVPDB171 | 30W | 4PJX |
- |
- |
SHOW | |
COVPDB1202 | OYD | 6PUD |
- |
- |
SHOW | |
COVPDB1253 | Q81 | 6PUL |
- |
- |
SHOW | |
COVPDB145 | 2LJ | 4NQC |
- |
- |
SHOW | |
COVPDB1251 | Q7P | 6PUI |
- |
- |
SHOW | |
COVPDB1250 | Q7J | 6PUE |
- |
- |
SHOW | |
COVPDB1254 | Q84 | 6PUM |
- |
- |
SHOW | |
COVPDB144 | 2L4 | 4NQE |
- |
- |
SHOW | |
COVPDB1252 | Q7S | 6PUJ |
- |
- |
SHOW | |
COVPDB145 | 2LJ | 6PUF |
- |
- |
SHOW | |
COVPDB385 | 7WO | 5U16 |
- |
- |
SHOW | |
COVPDB386 | 7WP | 5U17 |
- |
- |
SHOW | |
COVPDB145 | 2LJ | 5D5M |
- |
- |
SHOW | |
COVPDB171 | 30W | 4PJH |
- |
- |
SHOW | |
COVPDB171 | 30W | 4PJF |
- |
- |
SHOW | |
COVPDB171 | 30W | 4PJG |
- |
- |
SHOW | |
COVPDB1205 | OZD | 6PUG |
- |
- |
SHOW | |
COVPDB145 | 2LJ | 4PJ7 |
- |
- |
SHOW | |
COVPDB145 | Q87 | 6PUC |
- |
- |
SHOW | |
COVPDB145 | 2LJ | 4PJC |
- |
- |
SHOW | |
COVPDB308 | 6FP | 4L4T |
- |
- |
SHOW | |
COVPDB171 | 30W | 5D7I |
- |
- |
SHOW | |
COVPDB1204 | OYV | 6PUK |
- |
- |
SHOW | |
COVPDB389 | 7ZS | 5U6Q |
- |
- |
SHOW | |
COVPDB171 | 30W | 4PJ5 |
- |
- |
SHOW | |
COVPDB1203 | OYG | 6PUH |
- |
- |
SHOW | |
COVPDB171 | TKG | 6W9U |
- |
- |
SHOW | |
COVPDB171 | 30W | 4PJE |
- |
- |
SHOW | |
COVPDB145 | 2LJ | 5D7J |
- |
- |
SHOW |