Covpdb











Protein
Protein Name Proteasome subunit beta type-7
#PDB ID 4
Organism Homo sapiens (Human)
Uniprot ID/ACC Q99436 (PSB7_HUMAN)
Synonym(s)
  •   epididymis secretory sperm binding protein
  • macropain chain Z
  • multicatalytic endopeptidase complex chain Z
  • proteasome (prosome
  • macropain) subunit
  • beta type
  • 7
  • proteasome catalytic subunit 2
  • proteasome subunit Z
  • proteasome subunit alpha
  • proteasome subunit beta 7
  • proteasome subunit beta2
  • protein serine kinase c17
  • Z
show 13 synonym(s)
Gene Symbol PSMB7
Gene ID 5695
Sequence MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
Protein Class HYDROLASE
Function Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Within the 20S core complex, PSMB7 displays a trypsin-like activity.
Bound Ligands
Ligand ID HET Code PDB ID Binding Affinity Binding Database Structure Complex Card
COVPDB329 6V8 5LF7 IC50 : 7.7 nM, IC50 : 3500 nM, IC50 : 3.4 nM, IC50 : 31 nM BindingDB SHOW
COVPDB574 BO2 5LF3 IC50 : 4 nM, IC50 : 6.7 nM, IC50 : 6.2 nM, IC50 : 4.5 nM, IC50 : 97 nM, IC50 : 4.7 nM, IC50 : 1880 nM, IC50 : 7 nM, IC50 : 7.9 nM, IC50 : 8.3 nM, IC50 : 140 nM, IC50 : 0.5 nM, IC50 : 130 nM, IC50 : 2100 nM, Ki : 9.8 nM, IC50 : 2000 nM, IC50 : 120 nM, IC50 : 1930 nM, IC50 : 1.9 nM, IC50 : 8.96 nM, IC50 : 4.4 nM, IC50 : 3998 nM, IC50 : 19 nM, IC50 : 7.1 nM, IC50 : 28 nM, IC50 : 440 nM, IC50 : 30 nM, IC50 : 590 nM, Ki : 0.6 nM, IC50 : 700 nM, IC50 : 53 nM BindingDB SHOW
COVPDB330 6VC 5LF1
-
-
SHOW
COVPDB332 6VO 5LF0
-
-
SHOW