Protein |
||||||
| Protein Name | Endo-1,4-beta-xylanase 2 | |||||
|---|---|---|---|---|---|---|
| #PDB ID | 3 | |||||
| Organism | Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) (Trichoderma reesei) | |||||
| Uniprot ID/ACC | P36217 (XYN2_HYPJR) | |||||
| Synonym(s) | - | |||||
| Gene Symbol | xyn2 | |||||
| Gene ID | - | |||||
| Sequence | MVSFTSLLAGVAAISGVLAAPAAEVESVAVEKRQTIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS | |||||
| Protein Class | HYDROLASE | |||||
| Function | Glycoside hydrolase involved in the hydrolysis of xylan, a major plant cell wall hemicellulose made up of 1,4-beta-linked D-xylopyranose residues. Catalyzes the endohydrolysis of the main-chain 1,4-beta-glycosidic bonds connecting the xylose subunits yielding various xylooligosaccharides and xylose (PubMed:1369024, Ref. 5). The catalysis proceeds by a double-displacement reaction mechanism with a putative covalent glycosyl-enzyme intermediate, with retention of the anomeric configuration (PubMed:7988708). Produces xylobiose and xylose as the main degradation products (PubMed:19556747). |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
| COVPDB611 | C5X | 1RED |
- |
- |
 |
SHOW |
| COVPDB10 | 07E | 1REE |
- |
- |
 |
SHOW |
| COVPDB606 | C3X | 1REF |
- |
- |
 |
SHOW |