Protein |
||||||
| Protein Name | Protease | |||||
|---|---|---|---|---|---|---|
| #PDB ID | 4 | |||||
| Organism | Human adenovirus D serotype 8 (HAdV-8) (Human adenovirus 8) | |||||
| Uniprot ID/ACC | B9A5C1 (B9A5C1_ADE08) | |||||
| Synonym(s) | - | |||||
| Gene Symbol | L3 | |||||
| Gene ID | - | |||||
| Sequence | MSGSSEQELAAIVRDLGCGPYFLGTHDKRFPGFLAGNKLACAIVNTAGRETGGVHWLAFGWNPRSRTCYMFDPFGFSDRRLKQIYSFEYEAMLRRSALALSPDRCLSLEQSTQTVQGPDSAACGLFCCMFLHAFVHWPDRPMDGNPTMNLLTGVPNGMLQSPQVLPTLRRNQEKLYRFLAHHSPYFRSHRAAIEHATAFDKMKQLRV | |||||
| Protein Class | HYDROLASE | |||||
| Function | Cleaves viral precursor proteins (pTP, pIIIa, pVI, pVII, pVIII, and pX) inside newly assembled particles giving rise to mature virions. Protease complexed to its cofactor slides along the viral DNA to specifically locate and cleave the viral precursors. Mature virions have a weakened organization compared to the unmature virions, thereby facilitating subsequent uncoating. Without maturation, the particle lacks infectivity and is unable to uncoat. Late in adenovirus infection, in the cytoplasm, may participate in the cytoskeleton destruction. Cleaves host cell cytoskeletal keratins K7 and K18. |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
| COVPDB186 | 3FS | 4PIQ | IC50 : 80 nM | PDBBind |  |
SHOW |
| COVPDB187 | 3FU | 4PIS | IC50 : 60 nM | PDBBind |  |
SHOW |
| COVPDB203 | 3VJ | 4WX7 | IC50 : 40 nM | PDBBind |  |
SHOW |
| COVPDB204 | 3VK | 4WX6 | IC50 : <1 nM | PDBBind |  |
SHOW |