Protein |
||||||
| Protein Name | Haloalkane dehalogenase | |||||
|---|---|---|---|---|---|---|
| #PDB ID | 2 | |||||
| Organism | Rhodococcus rhodochrous | |||||
| Uniprot ID/ACC | P0A3G2 (DHAA_RHORH) | |||||
| Synonym(s) | - | |||||
| Gene Symbol | dhaA | |||||
| Gene ID | - | |||||
| Sequence | MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL | |||||
| Protein Class | HYDROLASE | |||||
| Function | Catalyzes hydrolytic cleavage of carbon-halogen bonds in halogenated aliphatic compounds, leading to the formation of the corresponding primary alcohols, halide ions and protons. Expresses halogenase activity against 1-chloroalkanes of chain length C3 to C10, and also shows a very weak activity with 1,2-dichloroethane. |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
| COVPDB403 | 8PM | 5UXZ |
- |
- |
 |
SHOW |
| COVPDB437 | 9FM | 5VNP |
- |
- |
 |
SHOW |