Protein |
||||||
Protein Name | Haloalkane dehalogenase | |||||
---|---|---|---|---|---|---|
#PDB ID | 2 | |||||
Organism | Rhodococcus rhodochrous | |||||
Uniprot ID/ACC | P0A3G2 (DHAA_RHORH) | |||||
Synonym(s) | - | |||||
Gene Symbol | dhaA | |||||
Gene ID | - | |||||
Sequence | MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL | |||||
Protein Class | HYDROLASE | |||||
Function | Catalyzes hydrolytic cleavage of carbon-halogen bonds in halogenated aliphatic compounds, leading to the formation of the corresponding primary alcohols, halide ions and protons. Expresses halogenase activity against 1-chloroalkanes of chain length C3 to C10, and also shows a very weak activity with 1,2-dichloroethane. |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
COVPDB403 | 8PM | 5UXZ |
- |
- |
|
SHOW |
COVPDB437 | 9FM | 5VNP |
- |
- |
|
SHOW |