Protein |
||||||
| Protein Name | Monoglyceride lipase | |||||
|---|---|---|---|---|---|---|
| #PDB ID | 3 | |||||
| Organism | Homo sapiens (Human) | |||||
| Uniprot ID/ACC | Q99685 (MGLL_HUMAN) | |||||
| Synonym(s) |
|
|||||
| Gene Symbol | MGLL | |||||
| Gene ID | 11343 | |||||
| Sequence | MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP | |||||
| Protein Class | HYDROLASE | |||||
| Function | Converts monoacylglycerides to free fatty acids and glycerol (PubMed:19029917, PubMed:20079333, PubMed:21049984, PubMed:22969151, PubMed:24368842). Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (PubMed:19029917, PubMed:20079333, PubMed:21049984, PubMed:22969151, PubMed:24368842). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (PubMed:20079333). |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
| COVPDB294 | 64D | 4UUQ | IC50 : 29 nM | PDBBind |  |
SHOW |
| COVPDB597 | C0S | 6AX1 | IC50 : 0.38 nM | PDBBind |  |
SHOW |
| COVPDB735 | E3A | 6BQ0 | IC50 : 46 nM | PDBBind |  |
SHOW |