| Protein Name |
Platelet-activating factor acetylhydrolase IB subunit alpha1 |
| #PDB ID |
1
|
| Organism |
Bos taurus (Bovine) |
| Uniprot ID/ACC |
Q29460 (PA1B3_BOVIN)
|
| Synonym(s) |
- PAF acetylhydrolase 29 kDa subunit
- PAF-AH 29 kDa subunit
- PAF-AH subunit gamma
- PAFAH subunit gamma
- platelet-activating factor acetylhydrolase 1b
- catalytic subunit 3 (29kDa)
- platelet-activating factor acetylhydrolase IB subunit gamma
show 6 synonym(s)
|
| Gene Symbol |
PAFAH1B3
|
| Gene ID |
282515
|
| Sequence |
MSGDENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLTQDQGQGGAPLPEPSP |
| Protein Class |
HYDROLASE |
| Function |
Alpha1 catalytic subunit of the cytosolic type I platelet-activating factor (PAF) acetylhydrolase (PAF-AH (I)) heterotetrameric enzyme that catalyzes the hydrolyze of the acetyl group at the sn-2 position of PAF and its analogs and modulates the action of PAF (PubMed:10542206). The activity and substrate specificity of PAF-AH (I) are affected by its subunit composition (PubMed:10542206). Both alpha1/alpha1 homodimer (PAFAH1B3/PAFAH1B3 homodimer) and alpha1/alpha2 heterodimer(PAFAH1B3/PAFAH1B2 heterodimer) hydrolyze 1-O-alkyl-2-acetyl-sn-glycero-3-phosphoric acid (AAGPA) more efficiently than PAF, but they have little hydrolytic activity towards 1-O-alkyl-2-acetyl-sn-glycero-3-phosphorylethanolamine (AAGPE) (PubMed:10542206). Plays an important role during the development of brain.
|
