Protein
Protein Name Glutathione S-transferase P
#PDB ID 1
Organism Homo sapiens (Human)
Uniprot ID/ACC P09211 (GSTP1_HUMAN)
Synonym(s)
  •   GST class-pi
  • GSTP1-1
  • deafness
  • X-linked 7
  • epididymis secretory protein Li 22
  • fatty acid ethyl ester synthase III
  • DFN7
  • FAEES3
  • GST3
  • GSTP
  • HEL-S-22
  • PI
show 11 synonym(s)
Gene Symbol GSTP1
Gene ID 2950
Sequence MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Protein Class HYDROLASE
Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911). Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276). Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Bound Ligands
Ligand ID HET Code PDB ID Binding Affinity Binding Database Structure Complex Card
COVPDB855 GF5 5X79 IC50 : 12000 nM PDBBind SHOW