Protein |
||||||
| Protein Name | Acidic phospholipase A2 BthA-1 | |||||
|---|---|---|---|---|---|---|
| #PDB ID | 1 | |||||
| Organism | Bothrops jararacussu (Jararacussu) | |||||
| Uniprot ID/ACC | Q8AXY1 (PA2A_BOTJR) | |||||
| Synonym(s) | - | |||||
| Gene Symbol | - | |||||
| Gene ID | - | |||||
| Sequence | MRTLWIMAVLLVGVEGSLWQFGKMINYVMGESGVLQYLSYGCYCGLGGQGQPTDATDRCCFVHDCCYGKVTGCDPKIDSYTYSKKNGDVVCGGDDPCKKQICECDRVATTCFRDNKDTYDIKYWFYGAKNCQEKSEPC | |||||
| Protein Class | HYDROLASE | |||||
| Function | Snake venom phospholipase A2 (PLA2) that displays edema-inducing activities (activity that is inhibited by EDTA and dexamethasone), inhibits phospholipid-dependent collagen/ADP-induced platelet aggregation, possess hypotensive as well as anticoagulant activities. In addition, this enzyme shows bactericidal activity against E.coli and S.aureus. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
| COVPDB1217 | PBP | 1Z76 |
- |
- |
 |
SHOW |