Protein |
||||||
Protein Name | Dihydropteroate synthase | |||||
---|---|---|---|---|---|---|
#PDB ID | 1 | |||||
Organism | Bacillus anthracis | |||||
Uniprot ID/ACC | Q81VW8 (Q81VW8_BACAN) | |||||
Synonym(s) | - | |||||
Gene Symbol | folP | |||||
Gene ID | - | |||||
Sequence | MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK | |||||
Protein Class | TRANSFERASE | |||||
Function | Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8-dihydropteroate (H2Pte), the immediate precursor of folate derivatives. |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
COVPDB533 | B59 | 3H2E |
- |
- |
SHOW |