Protein |
||||||
Protein Name | Staphopain A | |||||
---|---|---|---|---|---|---|
#PDB ID | 1 | |||||
Organism | Staphylococcus aureus | |||||
Uniprot ID/ACC | P81297 (SSPP_STAAU) | |||||
Synonym(s) | - | |||||
Gene Symbol | sspP | |||||
Gene ID | - | |||||
Sequence | MKRNFPKLIALSLIFSLSITPIANAESNSNIKAKDKRHVQVNVEDKSVPTDVRNLAQKDYLSYVTSLDKIYNKEKASYTLGEPFKIYKFNKKSDGNYYFPVLNTEGNIDYIVTISPKVTKDSSSSSKYTINVSSFLSKALNEYKDQQITILTNSKGYYVVTQNHKAKLVLKTPRLEDKKAKKTESIPTGNNVTQLKQKASVTMPTSQFKSNNYTYNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY | |||||
Protein Class | HYDROLASE | |||||
Function | Cysteine protease that plays an important role in the inhibition of host innate immune response. Cleaves host elastins found in connective tissues, pulmonary surfactant protein A in the lungs, and the chemokine receptor CXCR2 on leukocytes (PubMed:3422637, PubMed:23235402). Proteolytic cleavage of surfactant protein A impairs bacterial phagocytocis by neutrophils while CXCR2 degradation blocks neutrophil activation and chemotaxis (PubMed:3422637, PubMed:23235402). Additionally, promotes vascular leakage by activating the plasma kallikerin/kinin system, resulting in hypotension (PubMed:15897280). |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
COVPDB739 | E64 | 1CV8 |
- |
- |
|
SHOW |