| Protein Name |
ATP synthase subunit 9, mitochondrial |
| #PDB ID |
1
|
| Organism |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Uniprot ID/ACC |
P61829 (ATP9_YEAST)
|
| Synonym(s) |
show 1 synonym(s)
|
| Gene Symbol |
OLI1
|
| Gene ID |
24573116
|
| Sequence |
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV |
| Protein Class |
HYDROLASE |
| Function |
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1- containing the extramembraneous catalytic core and F0- containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.
|
