Protein |
||||||
| Protein Name | Acidic phospholipase A2 | |||||
|---|---|---|---|---|---|---|
| #PDB ID | 1 | |||||
| Organism | Gloydius halys (Chinese water mocassin) (Agkistrodon halys) | |||||
| Uniprot ID/ACC | P14418 (PA2A_GLOHA) | |||||
| Synonym(s) | - | |||||
| Gene Symbol | - | |||||
| Gene ID | - | |||||
| Sequence | SLIQFETLIMKVAKKSGMFWYSNYGCYCGWGGQGRPQDATDRCCFVHDCCYGKVTGCDPKMDVYSFSEENGDIVCGGDDPCKKEICECDRAAAICFRDNLTLYNDKKYWAFGAKNCPQEESEPC | |||||
| Protein Class | HYDROLASE | |||||
| Function | Snake venom phospholipase A2 (PLA2) that acts in vivo as an anti-thrombotic agent. Inhibits platelet aggregation induced by ADP, arachidonic acid, and thrombin. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
| COVPDB1217 | PBP | 1BK9 |
- |
- |
 |
SHOW |