Protein |
||||||
| Protein Name | Haloalkane dehalogenase | |||||
|---|---|---|---|---|---|---|
| #PDB ID | 1 | |||||
| Organism | Rhodococcus sp. | |||||
| Uniprot ID/ACC | P0A3G3 (DHAA_RHOSO) | |||||
| Synonym(s) | - | |||||
| Gene Symbol | dhaA | |||||
| Gene ID | - | |||||
| Sequence | MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL | |||||
| Protein Class | HYDROLASE | |||||
| Function | Catalyzes hydrolytic cleavage of carbon-halogen bonds in halogenated aliphatic compounds, leading to the formation of the corresponding primary alcohols, halide ions and protons. |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
| COVPDB400 | 8LL | 5Y2Y |
- |
- |
 |
SHOW |