Protein |
||||||
Protein Name | Haloalkane dehalogenase | |||||
---|---|---|---|---|---|---|
#PDB ID | 1 | |||||
Organism | Rhodococcus sp. | |||||
Uniprot ID/ACC | P0A3G3 (DHAA_RHOSO) | |||||
Synonym(s) | - | |||||
Gene Symbol | dhaA | |||||
Gene ID | - | |||||
Sequence | MSEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL | |||||
Protein Class | HYDROLASE | |||||
Function | Catalyzes hydrolytic cleavage of carbon-halogen bonds in halogenated aliphatic compounds, leading to the formation of the corresponding primary alcohols, halide ions and protons. |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
COVPDB400 | 8LL | 5Y2Y |
- |
- |
|
SHOW |