Protein |
||||||
| Protein Name | Type IV major pilin protein PilE1 | |||||
|---|---|---|---|---|---|---|
| #PDB ID | 1 | |||||
| Organism | Neisseria gonorrhoeae | |||||
| Uniprot ID/ACC | P02974 (FMM1_NEIGO) | |||||
| Synonym(s) | - | |||||
| Gene Symbol | pilE1 | |||||
| Gene ID | - | |||||
| Sequence | MNTLQKGFTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNHGKWPENNTSAGVASPPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRENGSVKWFCGQPVTRTDDDTVADAKDGKEIDTKHLPSTCRDNFDAK | |||||
| Protein Class | CELL CYCLE | |||||
| Function | Major component of the type IV pilus (T4P) that plays a role in cellular adherence, microcolony formation, resistance to neutrophil mediated killing, twitching motility as well as transformation (PubMed:27213957). Mediates the attachment and the formation of bacterial microcolonies on host epithelial cells. Mechanistically, pili retractation induces host NF-kappa-B activation in infected cells, which is temporally associated with the formation of gonococcal microcolonies (PubMed:27213957). |
Bound Ligands |
Ligand ID | HET Code | PDB ID | Binding Affinity | Binding Database | Structure | Complex Card |
| COVPDB1187 | OPE | 2HI2 |
- |
- |
 |
SHOW |