| Protein Name |
L,D-transpeptidase 2 |
| #PDB ID |
2
|
| Organism |
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Uniprot ID/ACC |
O53223 (LDT2_MYCTO)
|
| Synonym(s) |
-
|
| Gene Symbol |
ldtB
|
| Gene ID |
-
|
| Sequence |
MPKVGIAAQAGRTRVRRAWLTALMMTAVMIGAVACGSGRGPAPIKVIADKGTPFADLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA |
| Protein Class |
TRANSFERASE |
| Function |
Generates 3->3 cross-links in peptidoglycan, catalyzing the cleavage of the mDap3-D-Ala4 bond of a tetrapeptide donor stem and the formation of a bond between the carbonyl of mDap3 of the donor stem and the side chain of mDap3 of the acceptor stem. Is specific for donor substrates containing a stem tetrapeptide since it cannot use pentapeptide stems. Is essential for virulence in a mouse model of acute infection.
|
